PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9KG303900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 563aa    MW: 62971.8 Da    PI: 4.5613
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9KG303900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS412.53.9e-1261935622374
                 GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                          ++lL++cAea+s+ +  +aq+++a+l++ ++ +gdp qR+aay++e+Laa++++s++++y+al+++e++   +  +l+a+++++e++P++
  Pavir.9KG303900.1.p 193 KQLLFDCAEAISEYSVDEAQSIIAELRQKVAIQGDPSQRIAAYLVEGLAATIQSSGKGIYRALRCKEAP---TLYQLSAMQILFEICPCF 279
                          589*****************************************************************9...89999************* PP

                 GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefn 179
                          ++++++aN  Ilea +gee vHiiDfdi+qG Q+++L+q L + +++p  lRiTgv++ es+      l+ +g+rL+k+Ae +gvpfef+
  Pavir.9KG303900.1.p 280 RLGFMAANYSILEACKGEEVVHIIDFDINQGSQYITLIQFLRNNSNKPCLLRITGVDDLESVnrAVGGLKVVGQRLEKLAEDCGVPFEFR 369
                          **********************************************************9999888899********************** PP

                 GRAS 180 vlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfd 269
                          + va+++ed+++ +L++++gEal+Vn+++ lh+l+desvs+ +erd++L++vk+l+Pk+v++veq+a++n+++Fl+rf e  +yysalfd
  Pavir.9KG303900.1.p 370 T-VASNIEDVTPGMLDCRTGEALIVNFAFLLHHLPDESVSMVNERDQLLRMVKGLRPKLVTMVEQDANTNTTPFLARFREVYDYYSALFD 458
                          *.7*************************************************************************************** PP

                 GRAS 270 sleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslv 359
                          sl+a+lpres +r++vEr++l+reivn++aceg +r+er e ++kWr+r+++aGF p p+++++ + +k+ll+ + +  yr e+  + l 
  Pavir.9KG303900.1.p 459 SLDATLPRESPDRMNVERQCLAREIVNILACEGPDRVERYEVAGKWRARMTMAGFVPSPFNSNVIDGIKSLLKSYCD-KYRFEKVYDGLH 547
                          ***************************************************************************95.5*********** PP

                 GRAS 360 lgWkdrpLvsvSaWr 374
                          +gW d++Lv+ SaW+
  Pavir.9KG303900.1.p 548 FGWGDKTLVVSSAWQ 562
                          **************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.298166543IPR005202Transcription factor GRAS
PfamPF035141.4E-123193562IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 563 aa     Download sequence    Send to blast
MSFIRQADPS ASCAESPYIH KFGPPGSVFP AQRFASGKEL LHHGPQPYKS EGYRQSDFNG  60
TAAHVFQNSF YNTDSHVESH FNEATCSPAI SNVSQQNSQS LSDNQTSDLE VEFDEDEMRL  120
KLQELEHALL DDGDEIFSDL SGIIDDEWND SMKNNDWTNT MKNIMSPDSP KESSLESSLC  180
CPDSNNGEAR SPKQLLFDCA EAISEYSVDE AQSIIAELRQ KVAIQGDPSQ RIAAYLVEGL  240
AATIQSSGKG IYRALRCKEA PTLYQLSAMQ ILFEICPCFR LGFMAANYSI LEACKGEEVV  300
HIIDFDINQG SQYITLIQFL RNNSNKPCLL RITGVDDLES VNRAVGGLKV VGQRLEKLAE  360
DCGVPFEFRT VASNIEDVTP GMLDCRTGEA LIVNFAFLLH HLPDESVSMV NERDQLLRMV  420
KGLRPKLVTM VEQDANTNTT PFLARFREVY DYYSALFDSL DATLPRESPD RMNVERQCLA  480
REIVNILACE GPDRVERYEV AGKWRARMTM AGFVPSPFNS NVIDGIKSLL KSYCDKYRFE  540
KVYDGLHFGW GDKTLVVSSA WQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-441945626375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.167430.0callus| leaf| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004962026.10.0PREDICTED: scarecrow-like protein 1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLK3Z5170.0K3Z517_SETIT; Uncharacterized protein
STRINGSi021635m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP51753860
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1